PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462849343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 306aa    MW: 34185.7 Da    PI: 7.2669
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462849343genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox246.4e-082472802154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++++L +++gL+ +q+ +WF N+R +
  462849343 247 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 280
                569*****************************87 PP

2ELK26.91.1e-09201222122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y+++L+++++E++
  462849343 201 ELKHELKQGYKEKLIDIREEIL 222
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.0E-62266IPR005540KNOX1
PfamPF037905.5E-103465IPR005540KNOX1
SMARTSM012561.2E-2474130IPR005541KNOX2
PfamPF037912.8E-1883129IPR005541KNOX2
SMARTSM011880.004201222IPR005539ELK domain
PROSITE profilePS5121310.039201221IPR005539ELK domain
PROSITE profilePS5007111.742221284IPR001356Homeobox domain
SMARTSM003894.8E-11223288IPR001356Homeobox domain
SuperFamilySSF466895.56E-16223288IPR009057Homeodomain-like
CDDcd000864.70E-12224285No hitNo description
Gene3DG3DSA:1.10.10.603.4E-25228285IPR009057Homeodomain-like
PfamPF059208.1E-18241280IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MDALGNCPLP YSSCPAGAGT TRAEKSGSRD PLHLEQLLSA HVACLRIATP VDQLPRIDAQ  60
LAQSQGVLAK YSGLAAGAGD DLRELDQFMT HYVLLLCSFK EQLQQHVRVH AMEAVMACWE  120
LEQNLQSLTA HIKPSKFILT DSALTGASPG EGTGATMSDG EDDQADSEAN MYDPSLDGAD  180
SMGFGLPTES ERSLMERVRQ ELKHELKQGY KEKLIDIREE ILRKRRAGKL PGDTTSTLKA  240
WWQSHAKWPY PTEEDKARLV QETGLQLKQI NNWFINQRKR NWHSNPSSSS NVKSKRKRYK  300
IKLDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12224288872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277297RKRNWHSNPSSSSNVKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650701.11e-170PREDICTED: homeobox protein knotted-1-like 13 isoform X2
RefseqXP_015650702.11e-170PREDICTED: homeobox protein knotted-1-like 13 isoform X3
SwissprotQ0J6N41e-170KNOSD_ORYSJ; Homeobox protein knotted-1-like 13
TrEMBLA0A0D9X6D31e-170A0A0D9X6D3_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19650.11e-169(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-138KNOTTED1-like homeobox gene 3